| Catalog Code: | H00006386-A01 |
| Product Type: | Primary Antibody |
| Product Name: | SDCBP Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 6386 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SDCBP |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of tran |
| Alternate Names: | anti-SDCBP antibody, anti-syndecan binding protein (syntenin) antibody, anti-MDA-9 antibody, anti-ST1 antibody, anti-SYCL antibody, anti-TACIP18 antibody, anti-melanoma differentiation associated protein-9 antibody, anti-pro-TGF-alpha cytoplasmic domain-i |
| Immunogen: | SDCBP (NP_005616, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND* ... |
| Specificity: | SDCBP - syndecan binding protein (syntenin) |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | SDCBP |
| Omim ID: | 602217 |