ExactAntigen

SDCBP Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006386-A01
Product Type:Primary Antibody
Product Name:SDCBP Antibody
List Price:205
Clonality:Polyclonal
Gene ID:6386
Host:Mouse
Product Description:Mouse Polyclonal anti-SDCBP
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of tran
Alternate Names:anti-SDCBP antibody, anti-syndecan binding protein (syntenin) antibody, anti-MDA-9 antibody, anti-ST1 antibody, anti-SYCL antibody, anti-TACIP18 antibody, anti-melanoma differentiation associated protein-9 antibody, anti-pro-TGF-alpha cytoplasmic domain-i
Immunogen:SDCBP (NP_005616, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGND* ...
Specificity:SDCBP - syndecan binding protein (syntenin)
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SDCBP
Omim ID:602217
see all human SDCBP antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about