ExactAntigen

Mouse Monoclonal anti-CX3CL1 (1D6) | Novus Biologicals antibody product information
CatalogCode:H00006376-M01
ProductName:CX3CL1 Antibody
Product Description:Mouse Monoclonal anti-CX3CL1 (1D6)
Clone:1D6
Clonality:Monoclonal
Immunogen:CX3CL1 (AAH01163, 26 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Epitope:HHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGGMDESVVLEPEATGES* ...
Specificity:CX3CL1 - chemokine (C-X3-C motif) ligand 1
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG1 Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ABCD-3 antibody, anti-C3Xkine antibody, anti-CXC3 antibody, anti-CXC3C antibody, anti-NTN antibody, anti-NTT antibody, anti-SCYD1 antibody, anti-fractalkine antibody, anti-neurotactin antibody
ProteinTarget:CX3CL1 - chemokine (C-X3-C motif) ligand 1
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:6376
Gene_Symbol:CX3CL1
Omim_ID:601880 NB120-10371
order or
more information
:
company product webpage
request information:
Also see:
all human fractalkine antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about