| request information: |
|
| Catalog Code: | H00006358-M01 |
| Product Name: | CCL14 Antibody |
| Product Description: | Mouse Monoclonal anti-CCL14 (1F12) |
| Clone: | 1F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6358 |
| Gene Symbol: | CCL14 |
| Omim ID: | 601392 |
| Immunogen: | CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. |
| Epitope: | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
| Specificity: | CCL14 - chemokine (C-C motif) ligand 14 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CC-1 antibody, anti-CC-3 antibody, anti-CKb1 antibody, anti-HCC-1 antibody, anti-HCC-3 antibody, anti-MCIF antibody, anti-NCC-2 antibody, anti-NCC2 antibody, anti-SCYA14 antibody, anti-SCYL2 antibody, anti-SY14 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |