| request information: |
|
| Catalog Code: | H00006357-M09 |
| Product Name: | CCL13 Antibody |
| Product Description: | Mouse Monoclonal anti-CCL13 - chemokine (C-C motif) ligand 13 (S2) |
| Clone: | S2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6357 |
| Gene Symbol: | CCL13 |
| Immunogen: | CCL13 (AAH08621, 1 a.a. ~ 99 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKE
KWVQNYMKHLGRKAHTLKT* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CKb10 antibody, anti-MCP-4 antibody, anti-MGC17134 antibody, anti-NCC-1 antibody, anti-NCC1 antibody, anti-SCYA13 antibody, anti-SCYL1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |