ExactAntigen

CCL13 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006357-M04
Product Type:Primary Antibody
Product Name:CCL13 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6357
Host:Mouse
Clone:S1
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-CCL13 - chemokine (C-C motif) ligand 13 (S1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjace
Alternate Names:anti-CKb10 antibody, anti-MCP-4 antibody, anti-MGC17134 antibody, anti-NCC-1 antibody, anti-NCC1 antibody, anti-SCYA13 antibody, anti-SCYL1 antibody
Immunogen:CCL13 (AAH08621, 1 a.a. ~ 99 a.a) full length recombinant protein with GST tag.
Epitope:MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:CCL13
see all human CCL13 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about