| Catalog Code: | H00006357-M04 |
| Product Type: | Primary Antibody |
| Product Name: | CCL13 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6357 |
| Host: | Mouse |
| Clone: | S1 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-CCL13 - chemokine (C-C motif) ligand 13 (S1) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjace |
| Alternate Names: | anti-CKb10 antibody, anti-MCP-4 antibody, anti-MGC17134 antibody, anti-NCC-1 antibody, anti-NCC1 antibody, anti-SCYA13 antibody, anti-SCYL1 antibody |
| Immunogen: | CCL13 (AAH08621, 1 a.a. ~ 99 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is |
| Gene Symbol: | CCL13 |