ExactAntigen

CCL13 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00006357-A01
Product Name:CCL13 Antibody
Product Description:Mouse Polyclonal anti-CCL13
Clonality:Polyclonal
ListPrice:225
Gene ID:6357
Gene Symbol:CCL13
Omim ID:601391
Immunogen:CCL13 (AAH08621, 1 a.a. ~ 99 a.a) full length recombinant protein with GST tag.
Epitope:MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKE
KWVQNYMKHLGRKAHTLKT*
Specificity:CCL13 - chemokine (C-C motif) ligand 13
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:This gene is one of several Cys-Cys (CC) cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for monocytes, lymphocytes, basophils and eosinophils, but not neutrophils. This chemokine plays a role in accumulation of leukocytes during inflammation. It may also be involved in the recruitment of monocytes into the arterial wall during artherosclerosis.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CKb10 antibody, anti-MCP-4 antibody, anti-MGC17134 antibody, anti-NCC-1 antibody, anti-NCC1 antibody, anti-SCYA13 antibody, anti-SCYL1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CCL13 antibodies


2008©ExactAntigen home | browse | about