| request information: |
|
| Catalog Code: | H00006351-A01 |
| Product Name: | CCL4 Antibody |
| Product Description: | Mouse Polyclonal anti-CCL4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6351 |
| Gene Symbol: | CCL4 |
| Omim ID: | 182284 |
| Immunogen: | CCL4 (NP_002975, 24 a.a. ~ 93 a.a) partial recombinant protein with GST tag. |
| Epitope: | APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN* |
| Specificity: | CCL4 - chemokine (C-C motif) ligand 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACT2 antibody, anti-AT744.1 antibody, anti-Act-2 antibody, anti-G-26 antibody, anti-LAG1 antibody, anti-MIP-1-beta antibody, anti-MIP1B antibody, anti-SCYA2 antibody, anti-SCYA4 antibody, anti-cytokine antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |