ExactAntigen

SCN2B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006327-M01
Product Type:Primary Antibody
Product Name:SCN2B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6327
Host:Mouse
Clone:2G11-C12
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-SCN2B (2G11-C12)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Immunogen:SCN2B (AAH36793, 1 a.a. ~ 216 a.a) full length recombinant protein with GST tag.
Epitope:MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:SCN2B
Omim ID:601327,
see all human SCN2B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about