| request information: |
|
| Catalog Code: | H00006326-A01 |
| Product Name: | sodium channel, voltage-gated, type II, alpha 2 Antibody |
| Product Description: | Mouse Polyclonal anti-sodium channel, voltage-gated, type II, alpha 2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6326 |
| Gene Symbol: | SCN2A2 |
| Omim ID: | 601219, |
| Immunogen: | SCN2A2 (NP_066287, 273 a.a. ~ 363 a.a) partial recombinant protein with GST tag. |
| Epitope: | NLRNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGY
ICVKAGRNPNY* |
| Specificity: | sodium channel, voltage-gated, type II, alpha 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family. It is heterogeneously expressed in the brain, and mutations in this gene have been linked to several seizure disorders. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HBSCII antibody, anti-Nav1.2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |