ExactAntigen

SAA1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006288-M01
Product Type:Primary Antibody
Product Name:SAA1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6288
Host:Mouse
Clone:3C11-2C1
Isotype:IgG2b kappa
Product Description:Mouse Monoclonal anti-SAA1 (3C11-2C1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = SAA1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-PIG4 antibody, anti-SAA antibody, anti-TP53I4 antibody
Immunogen:SAA1 (AAH07022, 1 a.a. ~ 123 a.a) full length recombinant protein with GST tag.
Epitope:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY* ...
Specificity:SAA1 - serum amyloid A1
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been tested on tissue lysates and immunohistochemistry on paraffin imbedded sections
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:SAA1
Omim ID:104750
see all human SAA1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about