| CatalogCode: | H00006286-B01 |
| ProductName: | S100P Antibody |
| Product Description: | Mouse Polyclonal anti-S100P - S100 calcium binding protein P, MaxPab Antibody |
| Clonality: | Polyclonal |
| Immunogen: | S100P (AAH06819, 1 a.a. ~ 96 a.a) full-length human protein. |
| Epitope: | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK* ... |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against transfected protein with on ELISA and Western Blot. Untransfected protein used as a negative control. |
| Control: | H00006286-T01 |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | WB, ELISA |
| SpeciesSummary: | Hu |
| ALTnames: | anti-MIG9 antibody |
| ProteinTarget: | S100 calcium binding protein P |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova. |
| Gene_Id: | 6286 |
| Gene_Symbol: | S100P |