| Catalog Code: | H00006280-M01 |
| Product Type: | Primary Antibody |
| Product Name: | S100A9 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6280 |
| Host: | Mouse |
| Clone: | 1C10 |
| Isotype: | IgG Mix kappa |
| Product Description: | Mouse Monoclonal anti-S100A9 (1C10) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = S100A9 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode |
| Alternate Names: | anti-60B8AG antibody, anti-CAGB antibody, anti-CFAG antibody, anti-CGLB antibody, anti-L1AG antibody, anti-LIAG antibody, anti-MAC387 antibody, anti-MIF antibody, anti-MRP14 antibody, anti-NIF antibody, anti-P14 antibody |
| Immunogen: | S100A9 (AAH47681, 1 a.a. ~ 115 a.a) full length recombinant protein with GST tag. |
| Epitope: | MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP* ... |
| Specificity: | S100A9 - S100 calcium binding protein A9 (calgranulin B) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | S100A9 |
| Omim ID: | 123886 |