ExactAntigen

S100A8 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006279-M01
Product Type:Primary Antibody
Product Name:S100A8 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6279
Host:Mouse
Clone:2H2
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-S100A8 (2H2)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = S100A8 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode
Alternate Names:anti-60B8AG antibody, anti-CAGA antibody, anti-CFAG antibody, anti-CGLA antibody, anti-CP-10 antibody, anti-L1Ag antibody, anti-MA387 antibody, anti-MIF antibody, anti-MRP8 antibody, anti-NIF antibody, anti-P8 antibody
Immunogen:S100A8 (AAH05928, 1 a.a. ~ 94 a.a) full length recombinant protein with GST tag.
Epitope:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE* ...
Specificity:S100A8 - S100 calcium binding protein A8 (calgranulin A)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:S100A8
Omim ID:123885,
see all human S100A8 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about