ExactAntigen

S100A8 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006279-B01
Product Type:Primary Antibody
Product Name:S100A8 Antibody
List Price:275
Clonality:Polyclonal
Gene ID:6279
Host:Mouse
Product Description:Mouse Polyclonal anti-S100A8
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce
Alternate Names:anti-60B8AG antibody, anti-CAGA antibody, anti-CFAG antibody, anti-CGLA antibody, anti-CP-10 antibody, anti-L1Ag antibody, anti-MA387 antibody, anti-MIF antibody, anti-MRP8 antibody, anti-NIF antibody, anti-P8 antibody
Immunogen:S100A8 (AAH05928, 1 a.a. ~ 94 a.a) full-length human protein.
Epitope:MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE* ...
Specificity:Mouse polyclonal antibody raised against a full-length human S100A8 protein.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera
Application Summary:WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). MaxPab is a registered trademark of Abno
Gene Symbol:S100A8
Omim ID:123885,
see all human S100A8 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about