| CatalogCode: | H00006278-M02 |
| ProductName: | S100A7 Antibody |
| Product Description: | Mouse Monoclonal anti-S100A7 (1A4) |
| Clone: | 1A4 |
| Clonality: | Monoclonal |
| Immunogen: | S100A7 (AAH34687, 1 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. |
| Epitope: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ* ... |
| Specificity: | S100A7 - S100 calcium binding protein A7 (psoriasin 1) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-S100A7 antibody, anti-S100 calcium binding protein A7 (psoriasin 1)antibody, anti-HGNC:10497 antibody, anti-PSOR1 antibody, anti-S100A7cantibody, anti-S100 calcium-binding protein A7 antibody, anti-S100 calcium-binding protein A7 (psoriasin 1) antibody, anti-psoriasin 1 antibody, anti-Psoriasin antibody |
| ProteinTarget: | S100A7 - S100 calcium binding protein A7 (psoriasin 1) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 6278 |
| Gene_Symbol: | S100A7 |
| Omim_ID: | 600353, |