| request information: |
|
| Catalog Code: | H00006278-M01 |
| Product Name: | S100A7 Antibody |
| Product Description: | Mouse Monoclonal anti-S100A7 (1C5-C6) |
| Clone: | 1C5-C6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6278 |
| Gene Symbol: | S100A7 |
| Omim ID: | 600353 |
| Immunogen: | S100A7 (AAH34687, 1 a.a. ~ 102 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPN FLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIAT DYHKQSHGAAPCSGGSQ* |
| Specificity: | S100A7 - S100 calcium binding protein A7 (psoriasin 1) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Cytoplasmic. Also secreted by a non-classical secretory pathway. |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. This protein is markedly over-expressed in the skin lesions of psoriatic patients, but is excluded as a candidate gene for familial psoriasis susceptibility. The exact function of this protein is not known. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Psoriasin antibody, anti-HID 5 antibody, anti-Protein S100 A7 antibody, anti-PSOR 1 antibody, anti-PSOR1 antibody, anti-Psoriasin 1 antibody, anti-Psoriasin1 antibody, anti-S100 Calcium binding protein A7 antibody, anti-S100A7 antibody, anti-S100A7c antibody, anti-HGNC:10497 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |