| Catalog Code: | H00006278-B01 |
| Product Type: | Primary Antibody |
| Product Name: | S100A7 Antibody |
| List Price: | 275 |
| Clonality: | Polyclonal |
| Gene ID: | 6278 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-S100A7 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of ce |
| Alternate Names: | anti-PSOR1 antibody, anti-S100A7c antibody |
| Immunogen: | S100A7 (AAH34687, 1 a.a. ~ 102 a.a) full-length human protein. |
| Epitope: | MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ* ... |
| Specificity: | Mouse polyclonal antibody raised against a full-length human S100A7 protein. |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Application Summary: | WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). MaxPab is a registered trademark of Abno |
| Gene Symbol: | S100A7 |
| Omim ID: | 600353, |