ExactAntigen

S100A6 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006277-M16
Product Type:Primary Antibody
Product Name:S100A6 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6277
Host:Mouse
Clone:6D1
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-S100A6 (6D1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = S100A6 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode
Alternate Names:anti-2A9 antibody, anti-5B10 antibody, anti-CABP antibody, anti-CACY antibody, anti-PRA antibody
Immunogen:S100A6 (NP_055439, 18 a.a. ~ 91 a.a) partial recombinant protein with GST tag.
Epitope:KYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG* ...
Specificity:S100A6 - S100 calcium binding protein A6 (calcyclin)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:S100A6
Omim ID:114110,
see all human S100A6 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about