ExactAntigen

S100A4 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006275-M01
Product Type:Primary Antibody
Product Name:S100A4 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6275
Host:Mouse
Clone:1F12-1G7
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-S100A4 (1F12-1G7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = S100A4 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode
Alternate Names:anti-18A2 antibody, anti-42A antibody, anti-CAPL antibody, anti-MTS1 antibody, anti-P9KA antibody, anti-PEL98 antibody
Immunogen:S100A4 (AAH16300, 1 a.a. ~ 102 a.a) full length recombinant protein with GST tag.
Epitope:MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK* ...
Specificity:S100A4 - S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Product References:Chen PS, Kuo ML. et al. CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway. J Cell Sci. 2007 Jun 15;120(Pt 12):2053-65.
Novus References:Zeisberg, E.M., et al. Discovery of Endothelial to Mesenchymal Transition as a Source for Carcinoma-Associated Fibroblasts. Cancer Res. 2007 67: 10123-10128.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:S100A4
Omim ID:114210
see all human S100A4 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about