| Catalog Code: | H00006275-M01 |
| Product Type: | Primary Antibody |
| Product Name: | S100A4 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6275 |
| Host: | Mouse |
| Clone: | 1F12-1G7 |
| Isotype: | IgG1 kappa |
| Product Description: | Mouse Monoclonal anti-S100A4 (1F12-1G7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = S100A4 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode |
| Alternate Names: | anti-18A2 antibody, anti-42A antibody, anti-CAPL antibody, anti-MTS1 antibody, anti-P9KA antibody, anti-PEL98 antibody |
| Immunogen: | S100A4 (AAH16300, 1 a.a. ~ 102 a.a) full length recombinant protein with GST tag. |
| Epitope: | MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK* ... |
| Specificity: | S100A4 - S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Product References: | Chen PS, Kuo ML. et al. CTGF enhances the motility of breast cancer cells via an integrin-alphavbeta3-ERK1/2-dependent S100A4-upregulated pathway. J Cell Sci. 2007 Jun 15;120(Pt 12):2053-65. |
| Novus References: | Zeisberg, E.M., et al. Discovery of Endothelial to Mesenchymal Transition as a Source for Carcinoma-Associated Fibroblasts. Cancer Res. 2007 67: 10123-10128. |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | S100A4 |
| Omim ID: | 114210 |