| request information: |
|
| Catalog Code: | H00006274-A01 |
| Product Name: | S100A3 Antibody |
| Product Description: | Mouse Polyclonal anti-S100A3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6274 |
| Gene Symbol: | S100A3 |
| Omim ID: | 176992, |
| Immunogen: | S100A3 (NP_002951, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. |
| Epitope: | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSL
ACLCLYCHEYFKDCPSEPPCSQ* |
| Specificity: | S100A3 - S100 calcium binding protein A3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-S100E antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |