| request information: |
|
| Catalog Code: | H00006273-B01 |
| Product Name: | S100A2 Antibody |
| Product Description: | Mouse Polyclonal anti-S100A2 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 6273 |
| Gene Symbol: | S100A2 |
| Omim ID: | 176993, |
| Immunogen: | S100A2 (AAH02829, 1 a.a. ~ 98 a.a) full-length human protein. |
| Epitope: | MCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFL
ALITVMCNDFFQGCPDRP* |
| Specificity: | Mouse polyclonal antibody raised against a full-length human S100A2 protein. |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on transfected lysate. Abnova's recommended working dilutions for western analysis are as follows: 1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAN19 antibody, anti-MGC111539 antibody, anti-S100L antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |