| request information: |
|
| Catalog Code: | H00006271-M01 |
| Product Name: | S100A1 Antibody |
| Product Description: | Mouse Monoclonal anti-S100A1 (1D5) |
| Clone: | 1D5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6271 |
| Gene Symbol: | S100A1 |
| Omim ID: | 176940 |
| Immunogen: | S100A1 (NP_006262, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTEL SGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY* |
| Specificity: | S100A1 - S100 calcium binding protein A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Cytoplasmic and Nuclear |
| Background: | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-S100 antibody, anti-Bpb antibody, anti-NEF antibody, anti-S 100 protein alpha chain antibody, anti-S 100 PROTEIN BETA CHAIN antibody, anti-S 100 protein beta subunit antibody, anti-S100 alpha antibody,anti-S100 beta antibody , anti-S100 calcium binding protein A1 antibody, anti-S100 calcium binding protein B antibody, anti-S100 calcium binding protein beta neural antibody, anti-S100 protein alpha chain antibody, anti-S100 protein alpha polypeptide antibody, anti-S100 protein beta polypeptide neural antibody, anti-S100A antibody, anti-S100a1 antibody, anti-S100B antibody, anti-S100beta antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |