| Catalog Code: | H00006271-A01 |
| Product Type: | Primary Antibody |
| Product Name: | S100A1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 6271 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-S100A1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = 6271 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours. |
| Alternate Names: | anti-S100 antibody, anti-S100A antibody |
| Immunogen: | S100A1 (NP_006262, 1 a.a. ~ 76 a.a) partial recombinant protein with GST tag. |
| Epitope: | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEY* ... |
| Specificity: | S100A1 - S100 calcium binding protein A1 |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | S100A1 |
| Omim ID: | 176940 |