| request information: |
|
| Catalog Code: | H00006240-A01 |
| Product Name: | RRM1 Antibody |
| Product Description: | Mouse Polyclonal anti-RRM1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 6240 |
| Gene Symbol: | RRM1 |
| Omim ID: | 180410 |
| Immunogen: | RRM1 (NP_001024, 644 a.a. ~ 754 a.a) partial recombinant protein with GST tag. |
| Epitope: | DLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGAFIDQSQSLNIHIAEPNYGKLTS
MHFYGWKQGLKTGMYYLRTRPAANPIQFTLN* |
| Specificity: | RRM1 - ribonucleotide reductase M1 polypeptide |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | This gene encodes one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme essential for the production of deoxyribonucleotides prior to DNA synthesis in S phase of dividing cells. It is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocrotical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-R1 antibody, anti-RIR1 antibody, anti-RR1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |