ExactAntigen

RPS6KB2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00006199-M08
Product Type:Primary Antibody
Product Name:RPS6KB2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:6199
Host:Mouse
Clone:4B11
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-RPS6KB2 (4B11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B
Alternate Names:anti-KLS antibody, anti-P70-beta antibody, anti-P70-beta-1 antibody, anti-P70-beta-2 antibody, anti-S6K-beta2 antibody, anti-S6K2 antibody, anti-SRK antibody, anti-STK14B antibody, anti-p70(S6K)-beta antibody, anti-p70S6Kb antibody
Immunogen:RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Epitope:MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RPS6KB2
Omim ID:608939,
see all human RPS6KB2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about