| Catalog Code: | H00006199-M08 |
| Product Type: | Primary Antibody |
| Product Name: | RPS6KB2 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 6199 |
| Host: | Mouse |
| Clone: | 4B11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-RPS6KB2 (4B11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B |
| Alternate Names: | anti-KLS antibody, anti-P70-beta antibody, anti-P70-beta-1 antibody, anti-P70-beta-2 antibody, anti-S6K-beta2 antibody, anti-S6K2 antibody, anti-SRK antibody, anti-STK14B antibody, anti-p70(S6K)-beta antibody, anti-p70S6Kb antibody |
| Immunogen: | RPS6KB2 (AAH06106, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | RPS6KB2 |
| Omim ID: | 608939, |