| request information: |
|
| Catalog Code: | H00006051-M02 |
| Product Name: | arginyl aminopeptidase Antibody |
| Product Description: | Mouse Monoclonal anti-arginyl aminopeptidase (4E11) |
| Clone: | 4E11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 6051 |
| Gene Symbol: | RNPEP |
| Omim ID: | 602675, |
| Immunogen: | RNPEP (NP_064601, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. |
| Epitope: | GNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFAST
ASQLHSNVVNYVQQIVAPKGS* |
| Specificity: | arginyl aminopeptidase (aminopeptidase B) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZP547H084 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |