| request information: |
|
| Catalog Code: | H00005986-M08 |
| Product Name: | RFNG Antibody |
| Product Description: | Mouse Monoclonal anti-RFNG |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5986 |
| Gene Symbol: | RFNG |
| Omim ID: | 602578, |
| Immunogen: | RFNG (82 a.a. ~ 191 a.a) partial recombinant protein with GST tag. |
| Epitope: | LGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLSHGGPENPQNVVNVAGGFSLH
QDPTRFKSIHCLLYPDTDWCPRQKQGAPTS* |
| Specificity: | RFNG - radical fringe homolog (Drosophila) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Isotype: | IgG1 |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Package Size: | 0.1 mg |
| Preservative: | Contains no preservative |
order or
more information: | company product webpage |