| request information: |
|
| Catalog Code: | H00005984-M01 |
| Product Name: | RFC4 Antibody |
| Product Description: | Mouse Monoclonal anti-RFC4 (1C12) |
| Clone: | 1C12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5984 |
| Gene Symbol: | RFC4 |
| Omim ID: | 102577 |
| Immunogen: | RFC4 (AAH17452, 254 a.a. ~ 363 a.a) partial recombinant protein with GST tag. |
| Epitope: | GKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLA
EVDKCLADGADEHLQLISLCATVMQQLSQNC |
| Specificity: | RFC4 - replication factor C (activator 1) 4, 37kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kD. This gene encodes the 37 kD subunit. This subunit forms a core complex with the 36 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system. Alternatively spliced transcript variants encoding the same protein have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG Mix Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-A1 37 antibody, anti-A137 antibody, anti-Activator 1 37 antibody, anti-Activator 137 kDa subunit antibody, anti-Replication factor C 37 antibody, anti-Replication factor C37 kDa subunit antibody, anti-replication factor c4 antibody, anti-RFC 37 antibody, anti-RFC37 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |