| request information: |
|
| Catalog Code: | H00005980-A01 |
| Product Name: | REV3L Antibody |
| Product Description: | Mouse Polyclonal anti-REV3L |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5980 |
| Gene Symbol: | REV3L |
| Omim ID: | 602776, |
| Immunogen: | REV3L (NP_002903, 2953 a.a. ~ 3053 a.a) partial recombinant protein with GST tag. |
| Epitope: | GTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFK
LSRVNRELSKAPYLRQLLDQF* |
| Specificity: | REV3L - REV3-like, catalytic subunit of DNA polymerase zeta (yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-POLZ antibody, anti-REV3 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |