| request information: |
|
| Catalog Code: | H00005973-A01 |
| Product Name: | RENBP Antibody |
| Product Description: | Mouse Polyclonal anti-RENBP |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5973 |
| Gene Symbol: | RENBP |
| Omim ID: | 312420 |
| Immunogen: | RENBP (NP_002901, 301 a.a. ~ 401 a.a) partial recombinant protein with GST tag. |
| Epitope: | FCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKG
CFHVPRCLAMCEEMLGALLSR* |
| Specificity: | RENBP - renin binding protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The gene product inhibits renin activity by forming a dimer with renin, a complex known as high molecular weight renin. The encoded protein contains a leucine zipper domain, which is essential for its dimerization with renin. The gene product can catalyze the interconversion of N-acetylglucosamine to N-acetylmannosamine, indicating that it is a GlcNAc 2-epimerase. Transcript variants utilizing alternative promoters have been described in the literature. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RBP antibody, anti-RNBP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |