| request information: |
|
| Catalog Code: | H00005970-M01 |
| Product Name: | RELA Antibody |
| Product Description: | Mouse Monoclonal anti-RELA (8G3) |
| Clone: | 8G3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5970 |
| Gene Symbol: | RELA |
| Omim ID: | 164014, |
| Immunogen: | RELA (NP_068810, 432 a.a. ~ 506 a.a) partial recombinant protein with GST tag. |
| Epitope: | GEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSE FQQLLNQGIPVAPHTTEPMLMEYPEAITRLVT* |
| Specificity: | RELA - v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappa light polypeptide gene enhancer in B-cells 3, p65 (avian) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Localization: | Nuclear, but also found in the cytoplasm in an inactive form complexed to an inhibitor (I kappa B). |
| Background: | NFKB1 (MIM 164011) or NFKB2 (MIM 164012) is bound to REL (MIM 164910), RELA, or RELB (MIM 604758) to form the NFKB complex. The p50 (NFKB1)/p65 (RELA) heterodimer is the most abundant form of NFKB. The NFKB complex is inhibited by I-kappa-B proteins (NFKBIA, MIM 164008 or NFKBIB, MIM 604495), which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the I-kappa-B proteins by kinases (IKBKA, MIM 600664, or IKBKB, MIM 603258) marks them for destruction via the ubiquitination pathway, thereby allowing activation of the NFKB complex. Activated NFKB complex translocates into the nucleus and binds DNA at kappa-B-binding motifs such as 5-prime GGGRNNYYCC 3-prime or 5-prime HGGARNYYCC 3-prime (where H is A, C, or T; R is an A or G purine; and Y is a C or T pyrimidine).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Lambda |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-MGC131774 antibody, anti-NFKB3 antibody, anti-NFkB p65 antibody, anti-MGC131774 antibody, anti-NFKB 3 antibody, anti-NFKB3 antibody, anti-Nuclear Factor NF Kappa B p65 Subunit antibody, anti-Nuclear Factor Of Kappa Light Polypeptide Gene Enhancer In B Cells antibody, anti-RELA antibody, anti-Transcription Factor p65 antibody, anti-V Rel Avian Reticuloendotheliosis Viral Oncogene Homolog A antibody, anti-v-rel reticuloendotheliosis viral oncogene homolog A antibody |
| Package Size: | 0.05 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|