| request information: |
|
| Catalog Code: | H00005962-M06 |
| Product Name: | RDX Antibody |
| Product Description: | Mouse Monoclonal anti-RDX (1D9) |
| Clone: | 1D9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5962 |
| Gene Symbol: | RDX |
| Omim ID: | 179410 |
| Immunogen: | RDX (AAH47109, 1 a.a. ~ 584 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFK
FRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVL
EQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPK
IGFPWSEIRNISFNDKKF |
| Specificity: | RDX - radixin |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated version representing a pseudogene (RDXP2) was assigned to Xp21.3. Another pseudogene that seemed to lack introns (RDXP1) was mapped to 11p by Southern and PCR analyses. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-RDX antibody, anti-radixin antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |