| Catalog Code: | H00005962-M04 |
| Product Type: | Primary Antibody |
| Product Name: | RDX Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 5962 |
| Host: | Mouse |
| Clone: | 2E7 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-RDX (2E7) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated ver |
| Alternate Names: | anti-RDX antibody, anti-radixin antibody |
| Immunogen: | RDX (AAH47109, 1 a.a. ~ 584 a.a) full length recombinant protein with GST tag. |
| Epitope: | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKF ... |
| Specificity: | RDX - radixin |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | RDX |
| Omim ID: | 179410 |