ExactAntigen

RDX Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005962-M04
Product Type:Primary Antibody
Product Name:RDX Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5962
Host:Mouse
Clone:2E7
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-RDX (2E7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Radixin is a cytoskeletal protein that may be important in linking actin to the plasma membrane. It is highly similar in sequence to both ezrin and moesin. The radixin gene has been localized by fluorescence in situ hybridization to 11q23. A truncated ver
Alternate Names:anti-RDX antibody, anti-radixin antibody
Immunogen:RDX (AAH47109, 1 a.a. ~ 584 a.a) full length recombinant protein with GST tag.
Epitope:MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKF ...
Specificity:RDX - radixin
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RDX
Omim ID:179410
see all human radixin antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about