| request information: | |
| Catalog Code: | H00005934-M05 |
| Product Name: | RBL2 Antibody |
| Product Description: | Mouse Monoclonal anti-RBL2 - retinoblastoma-like 2 (p130) (3E3) |
| Clone: | 3E3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5934 |
| Gene Symbol: | RBL2 |
| Immunogen: | RBL2 (NP_005602, 416 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | VTPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRF AEMLYYKVLESVIEQEQKRLG* |
| Cross Reactivity: | Human. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-P130 antibody, anti-Rb2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or more information: | company product webpage |