ExactAntigen

RBL1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005933-M01
Product Type:Primary Antibody
Product Name:RBL1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5933
Host:Mouse
Clone:1A5
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-RBL1 (1A5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = RBL1 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-CP107 antibody, anti-MGC40006 antibody, anti-PRB1 antibody, anti-p107 antibody
Immunogen:RBL1 (AAH32247, 905 a.a. ~ 1014 a.a) partial recombinant protein with GST tag.
Epitope:IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR ...
Specificity:RBL1 - retinoblastoma-like 1 (p107)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RBL1
Omim ID:116957
see all human p107 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about