| request information: |
|
| Catalog Code: | H00005927-A01 |
| Product Name: | JARID1A Antibody |
| Product Description: | Mouse Polyclonal anti-JARID1A |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5927 |
| Gene Symbol: | JARID1A |
| Omim ID: | 180202 |
| Immunogen: | JARID1A (NP_005047, 191 a.a. ~ 291 a.a) partial recombinant protein with GST tag. |
| Epitope: | KVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVGLAMGTKDKEDEVTRRRKVT
NRSDAFNMQMRQRKGTLSVNF* |
| Specificity: | JARID1A - Jumonji, AT rich interactive domain 1A (RBBP2-like) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is a ubiquitously expressed nuclear protein. It binds directly, with several other proteins, to retinoblastoma protein which regulates cell proliferation. This protein also interacts with rhombotin-2 which functions distinctly in erythropoiesis and in T-cell leukemogenesis. Rhombotin-2 is thought to either directly affect the activity of the encoded protein or may indirectly modulate the functions of the retinoblastoma protein by binding to this protein. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RBBP2 antibody, anti-RBP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |