| request information: |
|
| Catalog Code: | H00005914-M03 |
| Product Name: | RARA Antibody |
| Product Description: | Mouse Monoclonal anti-RARA (2D2) |
| Clone: | 2D2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5914 |
| Gene Symbol: | RARA |
| Omim ID: | 180240, |
| Immunogen: | RARA (NP_000955, 315 a.a. ~ 425 a.a) partial recombinant protein with GST tag. |
| Epitope: | QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAE
RVITLKMEIPGSMPPLIQEMLENSEGLDTLS* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RARA antibody, anti-RAR antibody, anti-NR1B1 antibody, anti-retinoic acid receptor antibody, anti-alpha antibody, anti-Retinoic acid receptor antibody, anti-alpha polypeptide antibody, anti-nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form antibody, anti-nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR short form antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |