| request information: |
|
| Catalog Code: | H00005914-M01 |
| Product Name: | RARA Antibody |
| Product Description: | Mouse Monoclonal anti-RARA (2C9-1F8) |
| Clone: | 2C9-1F8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5914 |
| Gene Symbol: | RARA |
| Omim ID: | 180240 |
| Immunogen: | RARA (AAH08727, 1 a.a. ~ 463 a.a) full length recombinant protein with GST tag. |
| Epitope: | MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALT TLQHQLPVSGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRI YKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHR DKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKE VPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTT NNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQ |
| Specificity: | RARA - retinoic acid receptor, alpha |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Nuclear |
| Background: | Retinoic acid, a metabolite of vitamin A, is necessary for normal organogenesis but acts as a teratogen at high levels during embryonic and fetal development. Retinoic acid functions through its interaction with the nuclear protein, retinoic acid receptor (RAR). RAR belongs to the steroid and thyroid hormone superfamily of nuclear receptor proteins which exert their effects by binding to specific DNA response elements, thus regulating gene expression in target cells. RAR exists as three major subtypes: alpha, beta and gamma. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Retinoic Acid Receptor alpha antibody, anti-Acute Promelocytic Leukemia Breakpoint Cluster Region antibody, anti-NR1B1 antibody, anti-RAR A antibody, anti-RAR alpha antibody, anti-RAR alpha form antibody, anti-RAR antibody, anti-RARA antibody, anti-RARA protein antibody, anti-RARA/PML Fusion Gene antibody, anti-RARalpha antibody, anti-RARalpha1 antibody, anti-Retinoic acid receptor alpha polypeptide antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |