ExactAntigen

Mouse Polyclonal anti-RARA | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00005914-A01
ProductName: RARA Antibody
Product Description: Mouse Polyclonal anti-RARA
Clonality: Polyclonal
Immunogen: RARA (NP_000955, 315 a.a. ~ 425 a.a) partial recombinant protein with GST tag.
Epitope: QLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLS* ...
Specificity: RARA - retinoic acid receptor, alpha
CrossReactivity: Human. Other species not tested.
Packaging: 0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses: The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: Whole antisera
Host_Name: Mouse
ListPrice: 225
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-RARA antibody, anti-RAR antibody, anti-NR1B1 antibody, anti-retinoic acid receptor antibody, anti-alpha antibody, anti-Retinoic acid receptor antibody, anti-alpha polypeptide antibody, anti-nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR long form antibody, anti-nucleophosmin-retinoic acid receptor alpha fusion protein NPM-RAR short form antibody
ProteinTarget: RARA - retinoic acid receptor, alpha
PackageSize: 0.05 ml
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 5914
Gene_Symbol: RARA
Omim_ID: 180240 H00005914-M01
more information: company product webpage
Also see:
see all human RARA antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about