| request information: |
|
| Catalog Code: | H00005892-M02 |
| Product Name: | RAD51L3 Antibody |
| Product Description: | Mouse Monoclonal anti-RAD51L3 (1C8-3C12) |
| Clone: | 1C8-3C12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5892 |
| Gene Symbol: | RAD51L3 |
| Omim ID: | 602954, |
| Immunogen: | RAD51L3 (AAH14422, 1 a.a. ~ 329 a.a) full length recombinant protein with GST tag. |
| Epitope: | MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQFSAFPVNGADLYEELKTST
AILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCMAANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEE
EQAEALRRIQVVHAFDIFQMLDVLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTL
ARDLGMAVVVTNHITRDR |
| Specificity: | RAD51L3 - RAD51-like 3 (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This protein forms a complex with several other members of the RAD51 family, including RAD51L1, RAD51L2, and XRCC2. The protein complex formed with this protein has been shown to catalyze homologous pairing between single- and double-stranded DNA, and is thought to play a role in the early stage of recombinational repair of DNA. Several alternatively spliced transcript variants of this gene have been described, but the biological validity of some of them has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-HsTRAD antibody, anti-R51H3 antibody, anti-RAD51D antibody, anti-Trad antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |