ExactAntigen

RAD51C Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005889-M01
Product Type:Primary Antibody
Product Name:RAD51C Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5889
Host:Mouse
Clone:3F3-5C6
Isotype:IgG1 kappa
Product Description:Mouse Monoclonal anti-RAD51C (3F3-5C6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = RAD51C PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene is a mem
Alternate Names:anti-DNA repair protein RAD51 homolog 3 antibody, anti-RAD51 homolog C (S. cerevisiae) antibody, anti-RAD51L2 antibody, anti-Yeast RAD51 homolog 3 antibody
Immunogen:RAD51C (AAH00667, 1 a.a. ~ 135 a.a) full length recombinant protein with GST tag.
Epitope:MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL* ...
Specificity:RAD51C - RAD51 homolog C (S. cerevisiae)
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RAD51C
Omim ID:602774
see all human RAD51C antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about