| request information: |
|
| Catalog Code: | H00005888-A01 |
| Product Name: | RAD51 Antibody |
| Product Description: | Mouse Polyclonal anti-RAD51 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 5888 |
| Gene Symbol: | RAD51 |
| Omim ID: | 114480 179617 |
| Immunogen: | RAD51 (AAH01459, 1 a.a. ~ 243 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILAVAE
RYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRL
ADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGV
GDAKD* |
| Specificity: | RAD51 - RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. Transcript variants utilizing alternative polyA signals exist. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DNA repair protein RAD51 homolog 1 antibody, anti-E coli RecA homolog antibody, anti-HGNC:9817 antibody, anti-Homolog of E coli RecA antibody, anti-homolog of S cerevisiae RAD51 antibody, anti-HRAD51 antibody, anti-HsRad51 antibody, anti-HsT16930 antibody, anti-RAD51 S cerevisiae homolog antibody, anti-RAD51A antibody, anti-RECA antibody, anti-RecA like protein antibody, anti-recombination protein A antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |