ExactAntigen

RAC2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005880-M04
Product Type:Primary Antibody
Product Name:RAC2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5880
Host:Mouse
Clone:M1
Isotype:IgM Kappa
Product Description:Mouse Monoclonal anti-RAC2 (M1)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = RAC2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encoded
Alternate Names:anti-EN-7 antibody, anti-Gx antibody, anti-HSPC022 antibody
Immunogen:RAC2 (AAH01485, 1 a.a. ~ 193 a.a) full length recombinant protein with GST tag.
Epitope:MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL* ...
Specificity:RAC2 - ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
Purity:IgG purified
Packaging:100 ul of ascites
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RAC2
Omim ID:602049608203
see all human RAC2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about