| request information: | |
| Catalog Code: | H00005874-B01 |
| Product Name: | RAB27B Antibody |
| Product Description: | Mouse Polyclonal anti-RAB27B - RAB27B, member RAS oncogene family |
| Clone: | RAB27B, member RAS oncogene family |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 5874 |
| Gene Symbol: | RAB27B |
| Immunogen: | RAB27B (AAH27474, 1 a.a. ~ 219 a.a) full-length human protein. |
| Epitope: | MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQE RFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIP YFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or more information: | company product webpage |