ExactAntigen

RAB27A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00005873-M02
Product Type:Primary Antibody
Product Name:RAB27A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:5873
Host:Mouse
Clone:1G7
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-RAB27A (1G7)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = RAB27A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The protein encode
Alternate Names:anti-GS2 antibody, anti-HsT18676 antibody, anti-MGC117246 antibody, anti-RAB27 antibody, anti-RAM antibody
Immunogen:RAB27A (NP_004571, 122 a.a. ~ 222 a.a) partial recombinant protein with GST tag.
Epitope:YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC* ...
Specificity:RAB27A - RAB27A, member RAS oncogene family
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:RAB27A
Omim ID:603868, 607624,
see all human RAB27A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about