| request information: |
|
| Catalog Code: | H00005868-M09 |
| Product Name: | RAB5A Antibody |
| Product Description: | Mouse Monoclonal anti-RAB5A (5D1) |
| Clone: | 5D1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5868 |
| Gene Symbol: | RAB5A |
| Omim ID: | 179512, |
| Immunogen: | RAB5A (AAH01267, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. |
| Epitope: | KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSA
RGRGVDLTEPTQPTRNQCCSN |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgM Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-RAB5 antibody |
| Package Size: | 0.1 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |