| request information: |
|
| Catalog Code: | H00005865-M01 |
| Product Name: | RAB3B Antibody |
| Product Description: | Mouse Monoclonal anti-RAB3B (3F12) |
| Clone: | 3F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5865 |
| Gene Symbol: | RAB3B |
| Omim ID: | 179510 |
| Immunogen: | RAB3B (AAH05035, 120 a.a. ~ 219 a.a) partial recombinant protein with GST tag. |
| Epitope: | IKTYSWDNAQVILVGNKCDMEEERVVPTEKGQLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSML
GSSKNTRLSDTPPLLQQNCSC |
| Specificity: | RAB3B - RAB3B, member RAS oncogene family |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein, transfected lysate and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |