ExactAntigen

Mouse Monoclonal anti-PVRL2 (2A6-2C1)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00005819-M01
ProductName:PVRL2 Antibody
Product Description:Mouse Monoclonal anti-PVRL2 (2A6-2C1)
Clone:2A6-2C1
Clonality:Monoclonal
Immunogen:PVRL2 (AAH03091, 1 a.a. ~ 480 a.a) full length recombinant protein with GST tag.
Epitope:MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTL ...
Specificity:PVRL2 - poliovirus receptor-related 2 (herpesvirus entry mediator B)
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:This gene encodes a single-pass type I membrane glycoprotein with two Ig-like C2-type domains and an Ig-like V-type domain. This protein is one of the plasma membrane components of adherens junctions. It also serves as an entry for certain mutant strains of herpes simplex virus and pseudorabies virus, and it is involved in cell to cell spreading of these viruses. Variations in this gene have been associated with differences in the severity of multiple sclerosis. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CD112 antibody, anti-HVEB antibody, anti-PRR2 antibody, anti-PVRR2 antibody
ProteinTarget:PVRL2 - poliovirus receptor-related 2 (herpesvirus entry mediator B)
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:5819
Gene_Symbol:PVRL2
Omim_ID:600798 H00005819-B01
see all human PVRL2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about