| request information: |
|
| Catalog Code: | H00005802-M01 |
| Product Name: | PTPRS Antibody |
| Product Description: | Mouse Monoclonal anti-PTPRS (1H6) |
| Clone: | 1H6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 5802 |
| Gene Symbol: | PTPRS |
| Omim ID: | 601576 |
| Immunogen: | PTPRS (AAH29496, 1 a.a. ~ 129 a.a) full length recombinant protein with GST tag. |
| Epitope: | EPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKK VNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVG EITVHAKLTVLRGP |
| Specificity: | PTPRS - protein tyrosine phosphatase, receptor type, S |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Localization: | Cell Membrane; Single-pass type I membrane protein. |
| Background: | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an extracellular region, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus represents a receptor-type PTP. The extracellular region of this protein is composed of multiple Ig-like and fibronectin type III-like domains. Studies of the similar gene in mice suggested that this PTP may be involved in cell-cell interaction, primary axonogenesis, and axon guidance during embryogenesis. This PTP has been also implicated in the molecular control of adult nerve repair. Four alternatively spliced transcript variants, which encode distinct proteins, have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-EC 3.1.3.48 antibody, anti-Protein tyrosine phosphatase PTPsigma antibody, anti-Protein tyrosine phosphatase receptor type S antibody, anti-Protein tyrosine phosphatase receptor type sigma antibody, anti-Protein tyrosine phosphatase sigma antibody, anti-PTPSIGMA antibody, anti-R PTP sigma antibody, anti-Receptor type tyrosine protein phosphatase S precursor antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |