| request information: | |
| Catalog Code: | H00005799-B01 |
| Product Name: | PTPRN2 Antibody |
| Product Description: | Mouse Polyclonal anti-PTPRN2 - protein tyrosine phosphatase, receptor type, N polypeptide 2, MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 5799 |
| Gene Symbol: | PTPRN2 |
| Immunogen: | PTPRN2 (NP_570858, 1 a.a. ~ 986 a.a) full-length human protein. |
| Epitope: | MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGRCQKVPAMDFYRYEVSPVAL QRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRPEASSPARPSKHSVGSERRYSREGGAALANALRRHLPFL EALSQAPASDVLARTHTAQDRPPAEGDDRFSESILTYVAHTSALTYPPGPRTQLREDLLPRTLGQLQPDELSPKVDSGV DRHHLMAALSAYAAQRPP |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate and tissue lysate for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and a single intracellular catalytic domain, and thus represents a receptor-type PTP. The catalytic domain of this PTP is most closely related to PTPRN/IA-2beta. This PTP and PTPRN are both found to be major autoantigens associated with insulin-dependent diabetes mellitus. Three alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-IA-2beta antibody, anti-IAR antibody, anti-ICAAR antibody, anti-PTPRP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or more information: | company product webpage |